General Information

  • ID:  hor005328
  • Uniprot ID:  P04203
  • Protein name:  Exendin-1
  • Gene name:  NA
  • Organism:  Heloderma suspectum (Gila monster)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
  • Length:  38(1-38)
  • Propeptide:  HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T32 O-linked (GalNAc...) serine
  • Mutagenesis:  NA

Activity

  • Function:  They induce hypotension that is mediated by relaxation of cardiac smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P04203-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P04203-F1.pdbhor005328_AF2.pdbhor005328_ESM.pdb

Physical Information

Mass: 475574 Formula: C183H293N47O59
Absent amino acids: CMNVW Common amino acids: S
pI: 9.1 Basic residues: 5
Polar residues: 14 Hydrophobic residues: 12
Hydrophobicity: -32.63 Boman Index: -5370
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 82.37
Instability Index: 6215.26 Extinction Coefficient cystines: 2980
Absorbance 280nm: 80.54

Literature

  • PubMed ID:  6207171
  • Title:  Amino acid sequences of helospectins, new members of the glucagon superfamily, found in Gila monster venom.
  • PubMed ID:  10880980
  • Title:  Evidence that the lizard helospectin peptides are O-glycosylated.
  • PubMed ID:  9928018
  • Title:   Analogues of VIP, helodermin, and PACAP discriminate between rat and human VI
  • PubMed ID:  15003357
  • Title: